SCOP 1.73: Domain d1vq7e1: 1vq7 E:1-79

Lineage for d1vq7e1 (1vq7 E:1-79)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (2 species)
   duplication: consists of two domains of this fold

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)

8. Domain d1vq7e1: 1vq7 E:1-79 [120163]
   Other proteins in same PDB: d1vq711, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7f1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
   automatically matched to d1ffk11
   complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, pae, psu, ur3

Details for d1vq7e1

PDB Entry: 1vq7, 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (E:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1vq7e1:

Sequence; same for both SEQRES and ATOM records:

>d1vq7e1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

Timeline for d1vq7e1:

• d1vq7e1 is new in SCOP 1.73
  
• d1vq7e1 appears in SCOP 1.75
  
• d1vq7e1 appears in the current release, SCOPe 2.08