Lineage for d1vq7a2 (1vq7 A:1-90)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668391Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
    incomplete OB-fold lacking the last strand
  7. 668392Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
    includes the N-terminal tail
  8. 668421Domain d1vq7a2: 1vq7 A:1-90 [120159]
    Other proteins in same PDB: d1vq711, d1vq731, d1vq7a1, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
    automatically matched to d1s72a2
    complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, pae, psu, ur3

Details for d1vq7a2

PDB Entry: 1vq7 (more details), 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOP Domain Sequences for d1vq7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq7a2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap

SCOP Domain Coordinates for d1vq7a2:

Click to download the PDB-style file with coordinates for d1vq7a2.
(The format of our PDB-style files is described here.)

Timeline for d1vq7a2: