Lineage for d1vq7a1 (1vq7 A:91-237)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054645Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2054808Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 2054809Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 2054847Species Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
    Uniprot P20276
  8. 2054860Domain d1vq7a1: 1vq7 A:91-237 [120158]
    Other proteins in same PDB: d1vq711, d1vq721, d1vq731, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7g1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
    automatically matched to d1s72a1
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq7a1

PDB Entry: 1vq7 (more details), 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOPe Domain Sequences for d1vq7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq7a1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOPe Domain Coordinates for d1vq7a1:

Click to download the PDB-style file with coordinates for d1vq7a1.
(The format of our PDB-style files is described here.)

Timeline for d1vq7a1: