SCOPe 2.01: Domain d1vq6z1: 1vq6 Z:10-82

Lineage for d1vq6z1 (1vq6 Z:10-82)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)

6. Protein Ribosomal protein L37ae [57831] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
   Uniprot P60619

8. Domain d1vq6z1: 1vq6 Z:10-82 [120155]
   Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1
   automatically matched to d1s72z_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq6z1

PDB Entry: 1vq6, 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d1vq6z1:

Sequence; same for both SEQRES and ATOM records:

>d1vq6z1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

Timeline for d1vq6z1:

• d1vq6z1 first appeared in SCOP 1.73
  
• d1vq6z1 appears in SCOP 1.75
  
• d1vq6z1 appears in SCOPe 2.02
  
• d1vq6z1 appears in the current release, SCOPe 2.08