Lineage for d1vq6x1 (1vq6 X:7-88)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900678Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 1900679Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
    automatically mapped to Pfam PF01198
  5. 1900680Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 1900681Protein Ribosomal protein L31e [54577] (1 species)
  7. 1900682Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 1900699Domain d1vq6x1: 1vq6 X:7-88 [120153]
    Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6y1, d1vq6z1
    automatically matched to d1ffku_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq6x1

PDB Entry: 1vq6 (more details), 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1vq6x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq6x1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d1vq6x1:

Click to download the PDB-style file with coordinates for d1vq6x1.
(The format of our PDB-style files is described here.)

Timeline for d1vq6x1: