Lineage for d1vq6w1 (1vq6 W:1-154)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1207926Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 1207927Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 1207928Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 1207929Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 1207930Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
    Uniprot P14121
  8. 1207947Domain d1vq6w1: 1vq6 W:1-154 [120152]
    Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6x1, d1vq6y1, d1vq6z1
    automatically matched to d1ffkt_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq6w1

PDB Entry: 1vq6 (more details), 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d1vq6w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq6w1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d1vq6w1:

Click to download the PDB-style file with coordinates for d1vq6w1.
(The format of our PDB-style files is described here.)

Timeline for d1vq6w1: