SCOP 1.73: Domain d1vq6q1: 1vq6 Q:1-95

Lineage for d1vq6q1 (1vq6 Q:1-95)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L21e [50108] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)

8. Domain d1vq6q1: 1vq6 Q:1-95 [120146]
   Other proteins in same PDB: d1vq611, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1
   automatically matched to d1ffkn_
   complexed with 1ma, 5aa, aca, btn, cd, cl, hfa, k, mg, na, omg, omu, psu, ur3

Details for d1vq6q1

PDB Entry: 1vq6, 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOP Domain Sequences for d1vq6q1:

Sequence; same for both SEQRES and ATOM records:

>d1vq6q1 b.34.5.1 (Q:1-95) Ribosomal proteins L21e {Archaeon Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

Timeline for d1vq6q1:

• d1vq6q1 is new in SCOP 1.73
  
• d1vq6q1 appears in SCOP 1.75
  
• d1vq6q1 appears in the current release, SCOPe 2.08