Lineage for d1vq6o1 (1vq6 O:1-115)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980515Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 980516Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 980517Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 980609Protein Ribosomal protein L18e [52084] (1 species)
  7. 980610Species Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
    Uniprot P12733
  8. 980627Domain d1vq6o1: 1vq6 O:1-115 [120144]
    Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1
    automatically matched to d1ffkl_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq6o1

PDB Entry: 1vq6 (more details), 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (O:) 50S ribosomal protein L18e

SCOPe Domain Sequences for d1vq6o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq6o1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOPe Domain Coordinates for d1vq6o1:

Click to download the PDB-style file with coordinates for d1vq6o1.
(The format of our PDB-style files is described here.)

Timeline for d1vq6o1: