Lineage for d1vq6k1 (1vq6 K:1-132)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397397Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 2397398Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 2397399Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 2397400Protein Ribosomal protein L14 [50195] (5 species)
  7. 2397440Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
    Uniprot P22450
  8. 2397456Domain d1vq6k1: 1vq6 K:1-132 [120140]
    Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1
    automatically matched to d1s72k_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq6k1

PDB Entry: 1vq6 (more details), 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d1vq6k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq6k1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d1vq6k1:

Click to download the PDB-style file with coordinates for d1vq6k1.
(The format of our PDB-style files is described here.)

Timeline for d1vq6k1: