Lineage for d1vq6i1 (1vq6 I:71-140)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308802Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2308803Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2308804Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2308852Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
    Uniprot P14122 67-136
  8. 2308867Domain d1vq6i1: 1vq6 I:71-140 [120138]
    Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1
    automatically matched to d1s72i_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq6i1

PDB Entry: 1vq6 (more details), 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d1vq6i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq6i1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie

SCOPe Domain Coordinates for d1vq6i1:

Click to download the PDB-style file with coordinates for d1vq6i1.
(The format of our PDB-style files is described here.)

Timeline for d1vq6i1: