Lineage for d1vq6h1 (1vq6 H:1-163)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2189212Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2189213Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 2189214Protein Ribosomal protein L10e [54688] (2 species)
  7. 2189215Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
    Uniprot P60617
  8. 2189232Domain d1vq6h1: 1vq6 H:1-163 [120137]
    Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1
    automatically matched to d1s72h_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq6h1

PDB Entry: 1vq6 (more details), 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (H:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d1vq6h1:

Sequence, based on SEQRES records: (download)

>d1vq6h1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri

Sequence, based on observed residues (ATOM records): (download)

>d1vq6h1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscri

SCOPe Domain Coordinates for d1vq6h1:

Click to download the PDB-style file with coordinates for d1vq6h1.
(The format of our PDB-style files is described here.)

Timeline for d1vq6h1: