Lineage for d1vq631 (1vq6 3:1-92)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245344Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1245449Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 1245450Protein Ribosomal protein L44e [57837] (1 species)
  7. 1245451Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
    Uniprot P32411
  8. 1245468Domain d1vq631: 1vq6 3:1-92 [120128]
    Other proteins in same PDB: d1vq611, d1vq621, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1
    automatically matched to d1ffkz_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq631

PDB Entry: 1vq6 (more details), 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (3:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d1vq631:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq631 g.41.8.3 (3:1-92) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d1vq631:

Click to download the PDB-style file with coordinates for d1vq631.
(The format of our PDB-style files is described here.)

Timeline for d1vq631: