| Class g: Small proteins [56992] (92 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) ![]() |
| Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein) automatically mapped to Pfam PF01907 |
| Protein Ribosomal protein L37e [57834] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries) Uniprot P32410 |
| Domain d1vq611: 1vq6 1:1-56 [120127] Other proteins in same PDB: d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1 automatically matched to d1ffkx_ protein/RNA complex; complexed with cd, cl, k, mg, na |
PDB Entry: 1vq6 (more details), 2.7 Å
SCOPe Domain Sequences for d1vq611:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq611 g.41.8.2 (1:1-56) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d1vq611:
View in 3DDomains from other chains: (mouse over for more information) d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1 |