Lineage for d1vq5r1 (1vq5 R:1-150)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026181Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 1026182Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 1026183Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 1026184Protein Ribosomal protein L22 [54845] (5 species)
  7. 1026222Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 1026240Domain d1vq5r1: 1vq5 R:1-150 [120118]
    Other proteins in same PDB: d1vq511, d1vq521, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5g1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1
    automatically matched to d1ffko_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq5r1

PDB Entry: 1vq5 (more details), 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d1vq5r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq5r1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d1vq5r1:

Click to download the PDB-style file with coordinates for d1vq5r1.
(The format of our PDB-style files is described here.)

Timeline for d1vq5r1: