Lineage for d1vq5m1 (1vq5 M:1-194)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536709Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2536710Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2536822Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
    automatically mapped to Pfam PF00827
  6. 2536823Protein Ribosomal protein L15e [54194] (1 species)
  7. 2536824Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries)
    Uniprot P60618
  8. 2536838Domain d1vq5m1: 1vq5 M:1-194 [120113]
    Other proteins in same PDB: d1vq511, d1vq521, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5g1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1
    automatically matched to d1s72m_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq5m1

PDB Entry: 1vq5 (more details), 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (M:) 50S ribosomal protein L15e

SCOPe Domain Sequences for d1vq5m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq5m1 d.12.1.2 (M:1-194) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggka

SCOPe Domain Coordinates for d1vq5m1:

Click to download the PDB-style file with coordinates for d1vq5m1.
(The format of our PDB-style files is described here.)

Timeline for d1vq5m1: