| Class b: All beta proteins [48724] (176 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
| Protein N-terminal domain of ribosomal protein L2 [50299] (5 species) incomplete OB-fold lacking the last strand |
| Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries) Uniprot P20276 includes the N-terminal tail |
| Domain d1vq5a2: 1vq5 A:1-90 [120101] Other proteins in same PDB: d1vq511, d1vq521, d1vq531, d1vq5a1, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5g1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1 automatically matched to d1s72a2 protein/RNA complex; complexed with cd, cl, k, mg, na |
PDB Entry: 1vq5 (more details), 2.6 Å
SCOPe Domain Sequences for d1vq5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq5a2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap
Timeline for d1vq5a2:
View in 3DDomains from other chains: (mouse over for more information) d1vq511, d1vq521, d1vq531, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5g1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1 |