Lineage for d1vq5a2 (1vq5 A:1-90)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789194Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 1789232Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
    Uniprot P20276
    includes the N-terminal tail
  8. 1789247Domain d1vq5a2: 1vq5 A:1-90 [120101]
    Other proteins in same PDB: d1vq511, d1vq521, d1vq531, d1vq5a1, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5g1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1
    automatically matched to d1s72a2
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq5a2

PDB Entry: 1vq5 (more details), 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOPe Domain Sequences for d1vq5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq5a2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap

SCOPe Domain Coordinates for d1vq5a2:

Click to download the PDB-style file with coordinates for d1vq5a2.
(The format of our PDB-style files is described here.)

Timeline for d1vq5a2: