Lineage for d1vq4z1 (1vq4 Z:10-82)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751111Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 751112Protein Ribosomal protein L37ae [57831] (1 species)
  7. 751113Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (40 PDB entries)
  8. 751122Domain d1vq4z1: 1vq4 Z:10-82 [120097]
    Other proteins in same PDB: d1vq411, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1
    automatically matched to d1s72z_
    complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq4z1

PDB Entry: 1vq4 (more details), 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOP Domain Sequences for d1vq4z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq4z1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

SCOP Domain Coordinates for d1vq4z1:

Click to download the PDB-style file with coordinates for d1vq4z1.
(The format of our PDB-style files is described here.)

Timeline for d1vq4z1: