SCOP 1.73: Domain d1vq4x1: 1vq4 X:7-88

Lineage for d1vq4x1 (1vq4 X:7-88)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
   beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342

4. Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family)

5. Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)

6. Protein Ribosomal protein L31e [54577] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)

8. Domain d1vq4x1: 1vq4 X:7-88 [120095]
   Other proteins in same PDB: d1vq411, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4y1, d1vq4z1
   automatically matched to d1ffku_
   complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq4x1

PDB Entry: 1vq4, 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui

PDB Compounds: (X:) 50S ribosomal protein L31e

SCOP Domain Sequences for d1vq4x1:

Sequence; same for both SEQRES and ATOM records:

>d1vq4x1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

Timeline for d1vq4x1:

• d1vq4x1 is new in SCOP 1.73
  
• d1vq4x1 appears in SCOP 1.75
  
• d1vq4x1 appears in the current release, SCOPe 2.08