Lineage for d1vq4q1 (1vq4 Q:1-95)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796588Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 796589Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 796590Protein Ribosomal proteins L21e [50108] (1 species)
  7. 796591Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
    Uniprot P12734
  8. 796605Domain d1vq4q1: 1vq4 Q:1-95 [120088]
    Other proteins in same PDB: d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
    automatically matched to d1ffkn_
    complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq4q1

PDB Entry: 1vq4 (more details), 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOP Domain Sequences for d1vq4q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq4q1 b.34.5.1 (Q:1-95) Ribosomal proteins L21e {Archaeon Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOP Domain Coordinates for d1vq4q1:

Click to download the PDB-style file with coordinates for d1vq4q1.
(The format of our PDB-style files is described here.)

Timeline for d1vq4q1: