Lineage for d1vq4l1 (1vq4 L:1-150)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111852Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2111853Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2111854Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 2111855Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 2111893Species Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries)
    Uniprot P12737
  8. 2111909Domain d1vq4l1: 1vq4 L:1-150 [120083]
    Other proteins in same PDB: d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
    automatically matched to d1ffkj_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq4l1

PDB Entry: 1vq4 (more details), 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui
PDB Compounds: (L:) 50S ribosomal protein L15P

SCOPe Domain Sequences for d1vq4l1:

Sequence, based on SEQRES records: (download)

>d1vq4l1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d1vq4l1 c.12.1.1 (L:1-150) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOPe Domain Coordinates for d1vq4l1:

Click to download the PDB-style file with coordinates for d1vq4l1.
(The format of our PDB-style files is described here.)

Timeline for d1vq4l1: