Lineage for d1vq4i1 (1vq4 I:71-140)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984852Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1984853Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1984854Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1984902Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
    Uniprot P14122 67-136
  8. 1984917Domain d1vq4i1: 1vq4 I:71-140 [120080]
    Other proteins in same PDB: d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
    automatically matched to d1s72i_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq4i1

PDB Entry: 1vq4 (more details), 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d1vq4i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq4i1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie

SCOPe Domain Coordinates for d1vq4i1:

Click to download the PDB-style file with coordinates for d1vq4i1.
(The format of our PDB-style files is described here.)

Timeline for d1vq4i1: