SCOP 1.75: Domain d1vq4f1: 1vq4 F:1-119

Lineage for d1vq4f1 (1vq4 F:1-119)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
   Uniprot P12743

8. Domain d1vq4f1: 1vq4 F:1-119 [120078]
   Other proteins in same PDB: d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
   automatically matched to d1s72f_
   complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq4f1

PDB Entry: 1vq4, 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui

PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d1vq4f1:

Sequence; same for both SEQRES and ATOM records:

>d1vq4f1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

Timeline for d1vq4f1:

• d1vq4f1 first appeared in SCOP 1.73
  
• d1vq4f1 appears in SCOPe 2.01
  
• d1vq4f1 appears in the current release, SCOPe 2.08