SCOP 1.73: Domain d1vq4e2: 1vq4 E:80-172

Lineage for d1vq4e2 (1vq4 E:80-172)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (2 species)
   duplication: consists of two domains of this fold

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)

8. Domain d1vq4e2: 1vq4 E:80-172 [120077]
   Other proteins in same PDB: d1vq411, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4f1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
   automatically matched to d1ffk12
   complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq4e2

PDB Entry: 1vq4, 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui

PDB Compounds: (E:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1vq4e2:

Sequence; same for both SEQRES and ATOM records:

>d1vq4e2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

Timeline for d1vq4e2:

• d1vq4e2 is new in SCOP 1.73
  
• d1vq4e2 appears in SCOP 1.75
  
• d1vq4e2 appears in the current release, SCOPe 2.08