Lineage for d1vq4e2 (1vq4 E:80-172)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978336Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2978337Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2978338Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2978339Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2978411Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
    Uniprot P14135
  8. 2978439Domain d1vq4e2: 1vq4 E:80-172 [120077]
    Other proteins in same PDB: d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
    automatically matched to d1ffk12
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq4e2

PDB Entry: 1vq4 (more details), 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui
PDB Compounds: (E:) 50S ribosomal protein L6P

SCOPe Domain Sequences for d1vq4e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq4e2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

SCOPe Domain Coordinates for d1vq4e2:

Click to download the PDB-style file with coordinates for d1vq4e2.
(The format of our PDB-style files is described here.)

Timeline for d1vq4e2: