| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() |
| Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
| Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries) Uniprot P14135 |
| Domain d1vq4e1: 1vq4 E:1-79 [120076] Other proteins in same PDB: d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1 automatically matched to d1ffk11 complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, po2, psu, ur3 |
PDB Entry: 1vq4 (more details), 2.7 Å
SCOP Domain Sequences for d1vq4e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq4e1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg
Timeline for d1vq4e1:
View in 3DDomains from other chains: (mouse over for more information) d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1 |