Lineage for d1vq4c1 (1vq4 C:1-246)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691529Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423
  4. 691530Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 691531Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 691532Protein Ribosomal protein L4 [52168] (2 species)
    synonym: 50S ribosomal protein L4e, HMAL4, HL6
  7. 691533Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (44 PDB entries)
  8. 691542Domain d1vq4c1: 1vq4 C:1-246 [120074]
    Other proteins in same PDB: d1vq411, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
    automatically matched to d1jj2c_
    complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq4c1

PDB Entry: 1vq4 (more details), 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui
PDB Compounds: (C:) 50S ribosomal protein L4E

SCOP Domain Sequences for d1vq4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq4c1 c.22.1.1 (C:1-246) Ribosomal protein L4 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOP Domain Coordinates for d1vq4c1:

Click to download the PDB-style file with coordinates for d1vq4c1.
(The format of our PDB-style files is described here.)

Timeline for d1vq4c1: