Lineage for d1vq411 (1vq4 1:1-56)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966433Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1966495Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
    automatically mapped to Pfam PF01907
  6. 1966496Protein Ribosomal protein L37e [57834] (1 species)
  7. 1966497Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
    Uniprot P32410
  8. 1966513Domain d1vq411: 1vq4 1:1-56 [120069]
    Other proteins in same PDB: d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
    automatically matched to d1ffkx_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq411

PDB Entry: 1vq4 (more details), 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d1vq411:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq411 g.41.8.2 (1:1-56) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d1vq411:

Click to download the PDB-style file with coordinates for d1vq411.
(The format of our PDB-style files is described here.)

Timeline for d1vq411: