Lineage for d1vq1a_ (1vq1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130130Family c.66.1.30: N5-glutamine methyltransferase, HemK [89743] (2 protein domains)
  6. 2130142Protein automated matches [190080] (1 species)
    not a true protein
  7. 2130143Species Thermotoga maritima [TaxId:243274] [186801] (1 PDB entry)
  8. 2130144Domain d1vq1a_: 1vq1 A: [120067]
    automated match to d1sg9a_
    complexed with sam

Details for d1vq1a_

PDB Entry: 1vq1 (more details), 2.8 Å

PDB Description: Crystal structure of N5-glutamine methyltransferase, HemK(EC 2.1.1.-) (TM0488) from Thermotoga maritima at 2.80 A resolution
PDB Compounds: (A:) N5-glutamine methyltransferase, HemK

SCOPe Domain Sequences for d1vq1a_:

Sequence, based on SEQRES records: (download)

>d1vq1a_ c.66.1.30 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
rkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelve
krasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtg
sgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasi
emilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmeigedq
veelkkivsdtvflkdsagkyrflllnrrss

Sequence, based on observed residues (ATOM records): (download)

>d1vq1a_ c.66.1.30 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
rkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelve
krasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvadigtg
sgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkekfasi
emilsnppyvkssahlfeppealfggedgldfyreffgrydtsgkivlmeigedqveelk
kivsdtvflkdsagkyrflllnrrss

SCOPe Domain Coordinates for d1vq1a_:

Click to download the PDB-style file with coordinates for d1vq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1vq1a_: