Lineage for d1vpra1 (1vpr A:868-1218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805538Family b.60.1.7: Dinoflagellate luciferase repeat [141472] (1 protein)
    PfamB PB017809; comprises a fatty acid binding protein-like fold, wrapped into the extra N- and C-terminal 'tails'
  6. 2805539Protein Dinoflagellate luciferase [141473] (1 species)
  7. 2805540Species Lingulodinium polyedrum [TaxId:160621] [141474] (1 PDB entry)
    Uniprot O77206 868-1218
  8. 2805541Domain d1vpra1: 1vpr A:868-1218 [120066]

Details for d1vpra1

PDB Entry: 1vpr (more details), 1.8 Å

PDB Description: Crystal structure of a luciferase domain from the dinoflagellate Lingulodinium polyedrum
PDB Compounds: (A:) luciferase

SCOPe Domain Sequences for d1vpra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpra1 b.60.1.7 (A:868-1218) Dinoflagellate luciferase {Lingulodinium polyedrum [TaxId: 160621]}
ekgfeagdnklggalnakhvekygdnfkngmhkpefhedglhkpmevggkkfesgfhyll
echelggknasggyggplcedpygsevqamtekllkeadsdrtlcfnnfqdpcpqltkeq
vamckgfdygdktlklpcgplpwpaglpepgyvpktnplhgrwitvsggqaafikeaiks
gmlgaaeankivadtdhhqtggmylrinqfgdvctvdasvakfarakrtwksghyfyepl
vsggnllgvwvlpeeyrkigffwemesgrcfrierrafpvgpytfmrqatevggkisfvf
yvkvsndpesdpiplqsrdytalagrdnaptnlgkpyptlakdldypkkrd

SCOPe Domain Coordinates for d1vpra1:

Click to download the PDB-style file with coordinates for d1vpra1.
(The format of our PDB-style files is described here.)

Timeline for d1vpra1: