![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.7: Dinoflagellate luciferase repeat [141472] (1 protein) PfamB PB017809; comprises a fatty acid binding protein-like fold, wrapped into the extra N- and C-terminal 'tails' |
![]() | Protein Dinoflagellate luciferase [141473] (1 species) |
![]() | Species Lingulodinium polyedrum [TaxId:160621] [141474] (1 PDB entry) Uniprot O77206 868-1218 |
![]() | Domain d1vpra1: 1vpr A:868-1218 [120066] |
PDB Entry: 1vpr (more details), 1.8 Å
SCOPe Domain Sequences for d1vpra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vpra1 b.60.1.7 (A:868-1218) Dinoflagellate luciferase {Lingulodinium polyedrum [TaxId: 160621]} ekgfeagdnklggalnakhvekygdnfkngmhkpefhedglhkpmevggkkfesgfhyll echelggknasggyggplcedpygsevqamtekllkeadsdrtlcfnnfqdpcpqltkeq vamckgfdygdktlklpcgplpwpaglpepgyvpktnplhgrwitvsggqaafikeaiks gmlgaaeankivadtdhhqtggmylrinqfgdvctvdasvakfarakrtwksghyfyepl vsggnllgvwvlpeeyrkigffwemesgrcfrierrafpvgpytfmrqatevggkisfvf yvkvsndpesdpiplqsrdytalagrdnaptnlgkpyptlakdldypkkrd
Timeline for d1vpra1: