Lineage for d1vmca1 (1vmc A:8-67)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852363Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 852364Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 852365Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 852569Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)
  7. 852570Species Human (Homo sapiens) [TaxId:9606] [54151] (6 PDB entries)
  8. 852577Domain d1vmca1: 1vmc A:8-67 [120065]
    automatically matched to d1sdf__

Details for d1vmca1

PDB Entry: 1vmc (more details)

PDB Description: stroma cell-derived factor-1alpha (sdf-1alpha)
PDB Compounds: (A:) Stromal cell-derived factor 1

SCOP Domain Sequences for d1vmca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmca1 d.9.1.1 (A:8-67) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
rcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeylekaln

SCOP Domain Coordinates for d1vmca1:

Click to download the PDB-style file with coordinates for d1vmca1.
(The format of our PDB-style files is described here.)

Timeline for d1vmca1: