![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein Phosphatase hPTP1e [50168] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [74930] (3 PDB entries) |
![]() | Domain d1vj6a1: 1vj6 A:9-102 [120064] Other proteins in same PDB: d1vj6a2 automatically matched to d1gm1a_ |
PDB Entry: 1vj6 (more details)
SCOPe Domain Sequences for d1vj6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vj6a1 b.36.1.1 (A:9-102) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} kpgdtfevelaktdgslgisvtggvntsvrhggiyvkaiipkgaaesdgrihkgdrvlav ngvslegathkqavetlrntgqvvhlllekgqvp
Timeline for d1vj6a1: