SCOPe 2.08: Domain d1vj6a1: 1vj6 A:9-102

Lineage for d1vj6a1 (1vj6 A:9-102)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Phosphatase hPTP1e [50168] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [74930] (3 PDB entries)

8. Domain d1vj6a1: 1vj6 A:9-102 [120064]
   Other proteins in same PDB: d1vj6a2
   automatically matched to d1gm1a_

Details for d1vj6a1

PDB Entry: 1vj6

PDB Description: pdz2 from ptp-bl in complex with the c-terminal ligand from the apc protein

PDB Compounds: (A:) protein-tyrosine-phosphatase (nonreceptor type 13)

SCOPe Domain Sequences for d1vj6a1:

Sequence; same for both SEQRES and ATOM records:

>d1vj6a1 b.36.1.1 (A:9-102) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]}
kpgdtfevelaktdgslgisvtggvntsvrhggiyvkaiipkgaaesdgrihkgdrvlav
ngvslegathkqavetlrntgqvvhlllekgqvp

Timeline for d1vj6a1:

• d1vj6a1 first appeared in SCOP 1.73
  
• d1vj6a1 appears in SCOPe 2.07