Lineage for d1vgnb_ (1vgn B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2603069Protein automated matches [190079] (12 species)
    not a true protein
  7. 2603266Species Serratia marcescens [TaxId:615] [186800] (8 PDB entries)
  8. 2603288Domain d1vgnb_: 1vgn B: [120063]
    automated match to d1jjeb_
    complexed with acy, ops, zn

Details for d1vgnb_

PDB Entry: 1vgn (more details), 2.63 Å

PDB Description: Structure-based design of the irreversible inhibitors to metallo--lactamase (IMP-1)
PDB Compounds: (B:) beta-lactamase imp-1

SCOPe Domain Sequences for d1vgnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgnb_ d.157.1.1 (B:) automated matches {Serratia marcescens [TaxId: 615]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglnesk

SCOPe Domain Coordinates for d1vgnb_:

Click to download the PDB-style file with coordinates for d1vgnb_.
(The format of our PDB-style files is described here.)

Timeline for d1vgnb_: