SCOPe 2.08: Domain d1vgna_: 1vgn A:

Lineage for d1vgna_ (1vgn A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Serratia marcescens [TaxId:615] [186800] (10 PDB entries)

8. Domain d1vgna_: 1vgn A: [120062]
   automated match to d1jjeb_
   complexed with acy, ops, zn

Details for d1vgna_

PDB Entry: 1vgn, 2.63 Å

PDB Description: Structure-based design of the irreversible inhibitors to metallo--lactamase (IMP-1)

PDB Compounds: (A:) beta-lactamase imp-1

SCOPe Domain Sequences for d1vgna_:

Sequence; same for both SEQRES and ATOM records:

>d1vgna_ d.157.1.1 (A:) automated matches {Serratia marcescens [TaxId: 615]}
lpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtwf
vergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvny
wlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakll
kskygkaklvvpshsevgdasllkltleqavkglnes

Timeline for d1vgna_:

• d1vgna_ first appeared in SCOP 1.73, called d1vgna1
  
• d1vgna_ appears in SCOPe 2.07