Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (31 species) not a true protein |
Species Thermoactinomyces vulgaris [TaxId:2026] [254920] (8 PDB entries) |
Domain d1vfub3: 1vfu B:121-502 [120060] Other proteins in same PDB: d1vfua1, d1vfua2, d1vfub1, d1vfub2 automated match to d1ji2a3 complexed with ca |
PDB Entry: 1vfu (more details), 3.1 Å
SCOPe Domain Sequences for d1vfub3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfub3 c.1.8.1 (B:121-502) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]} vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh nterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn rglfefykelirlrhrlasltr
Timeline for d1vfub3: