SCOP 1.75: Domain d1vfub1: 1vfu B:1-120

Lineage for d1vfub1 (1vfu B:1-120)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (16 PDB entries)

8. Domain d1vfub1: 1vfu B:1-120 [120058]
   Other proteins in same PDB: d1vfua2, d1vfua3, d1vfub2, d1vfub3
   automatically matched to d1bvza1
   complexed with ca, glc; mutant

Details for d1vfub1

PDB Entry: 1vfu, 3.1 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 amylase 2/gamma- cyclodextrin complex

PDB Compounds: (B:) Neopullulanase 2

SCOP Domain Sequences for d1vfub1:

Sequence; same for both SEQRES and ATOM records:

>d1vfub1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1vfub1:

• d1vfub1 first appeared in SCOP 1.73
  
• d1vfub1 appears in SCOPe 2.01
  
• d1vfub1 appears in the current release, SCOPe 2.08