Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Maltogenic amylase, central domain [51465] (4 species) contains an additional N-terminal domain |
Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (16 PDB entries) |
Domain d1vfua3: 1vfu A:121-502 [120057] Other proteins in same PDB: d1vfua1, d1vfua2, d1vfub1, d1vfub2 automatically matched to d1bvza3 complexed with ca, glc; mutant |
PDB Entry: 1vfu (more details), 3.1 Å
SCOP Domain Sequences for d1vfua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfua3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh nterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn rglfefykelirlrhrlasltr
Timeline for d1vfua3: