Lineage for d1vfua2 (1vfu A:503-585)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328173Protein Maltogenic amylase [51031] (4 species)
  7. 1328188Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries)
  8. 1328215Domain d1vfua2: 1vfu A:503-585 [120056]
    Other proteins in same PDB: d1vfua1, d1vfua3, d1vfub1, d1vfub3
    automatically matched to d1bvza2
    complexed with ca

Details for d1vfua2

PDB Entry: 1vfu (more details), 3.1 Å

PDB Description: Crystal structure of Thermoactinomyces vulgaris R-47 amylase 2/gamma-cyclodextrin complex
PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d1vfua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfua2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d1vfua2:

Click to download the PDB-style file with coordinates for d1vfua2.
(The format of our PDB-style files is described here.)

Timeline for d1vfua2: