Lineage for d1vfua1 (1vfu A:1-120)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. Protein automated matches [190226] (79 species)
    not a true protein
  7. Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (8 PDB entries)
  8. Domain d1vfua1: 1vfu A:1-120 [120055]
    Other proteins in same PDB: d1vfua2, d1vfua3, d1vfub2, d1vfub3
    automated match to d1wzla1
    complexed with ca

Details for d1vfua1

PDB Entry: 1vfu (more details), 3.1 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 amylase 2/gamma- cyclodextrin complex
PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d1vfua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfua1 b.1.18.0 (A:1-120) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOPe Domain Coordinates for d1vfua1 are not available.

Timeline for d1vfua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vfua2, d1vfua3
View in 3D
Domains from other chains:
(mouse over for more information)
d1vfub1, d1vfub2, d1vfub3