SCOPe 2.05: Domain d1vfoa2: 1vfo A:503-585

Lineage for d1vfoa2 (1vfo A:503-585)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (30 species)
   not a true protein

7. Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (6 PDB entries)

8. Domain d1vfoa2: 1vfo A:503-585 [120049]
   Other proteins in same PDB: d1vfoa1, d1vfoa3, d1vfob1, d1vfob3
   automated match to d1wzla2
   complexed with ca

Details for d1vfoa2

PDB Entry: 1vfo, 2.81 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 2/beta-cyclodextrin complex

PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d1vfoa2:

Sequence; same for both SEQRES and ATOM records:

>d1vfoa2 b.71.1.0 (A:503-585) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1vfoa2:

• d1vfoa2 first appeared in SCOP 1.73
  
• d1vfoa2 appears in SCOPe 2.04
  
• d1vfoa2 appears in SCOPe 2.06
  
• d1vfoa2 appears in the current release, SCOPe 2.08