Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (39 species) not a true protein |
Domain d1vfoa1: 1vfo A:1-120 [120048] Other proteins in same PDB: d1vfoa2, d1vfoa3, d1vfob2, d1vfob3 automated match to d1wzla1 complexed with ca |
PDB Entry: 1vfo (more details), 2.81 Å
SCOPe Domain Sequences for d1vfoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfoa1 b.1.18.0 (A:1-120) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]} mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
Timeline for d1vfoa1: