Lineage for d1vfoa1 (1vfo A:1-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766547Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (8 PDB entries)
  8. 2766556Domain d1vfoa1: 1vfo A:1-120 [120048]
    Other proteins in same PDB: d1vfoa2, d1vfoa3, d1vfob2, d1vfob3
    automated match to d1wzla1
    complexed with ca

Details for d1vfoa1

PDB Entry: 1vfo (more details), 2.81 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 2/beta-cyclodextrin complex
PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d1vfoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfoa1 b.1.18.0 (A:1-120) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOPe Domain Coordinates for d1vfoa1:

Click to download the PDB-style file with coordinates for d1vfoa1.
(The format of our PDB-style files is described here.)

Timeline for d1vfoa1: