Lineage for d1vfmb2 (1vfm B:503-585)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420422Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2420423Protein automated matches [226835] (41 species)
    not a true protein
  7. 2420649Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (8 PDB entries)
  8. 2420661Domain d1vfmb2: 1vfm B:503-585 [120046]
    Other proteins in same PDB: d1vfma1, d1vfma3, d1vfmb1, d1vfmb3
    automated match to d1wzla2
    complexed with ca

Details for d1vfmb2

PDB Entry: 1vfm (more details), 2.9 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 2/alpha-cyclodextrin complex
PDB Compounds: (B:) Neopullulanase 2

SCOPe Domain Sequences for d1vfmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfmb2 b.71.1.0 (B:503-585) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d1vfmb2:

Click to download the PDB-style file with coordinates for d1vfmb2.
(The format of our PDB-style files is described here.)

Timeline for d1vfmb2: