| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (8 PDB entries) |
| Domain d1vfmb1: 1vfm B:1-120 [120045] Other proteins in same PDB: d1vfma2, d1vfma3, d1vfmb2, d1vfmb3 automated match to d1wzla1 complexed with ca |
PDB Entry: 1vfm (more details), 2.9 Å
SCOPe Domain Sequences for d1vfmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfmb1 b.1.18.0 (B:1-120) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
Timeline for d1vfmb1: