Lineage for d1vfia1 (1vfi A:4-95)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 752118Fold g.84: Cysteine zipper [144128] (1 superfamily)
    string of helices that contain cysteines at almost every turn; folds upon itself and is crosslnked by multiple disulfides
  4. 752119Superfamily g.84.1: Vanabin-like [144129] (1 family) (S)
  5. 752120Family g.84.1.1: Vanabin-like [144130] (1 protein)
  6. 752121Protein Vanadium-binding protein 2, vanabin 2 [144131] (1 species)
  7. 752122Species Vanadium-rich ascidian (Ascidia sydneiensis samea) [TaxId:79730] [144132] (1 PDB entry)
  8. 752123Domain d1vfia1: 1vfi A:4-95 [120034]

Details for d1vfia1

PDB Entry: 1vfi (more details)

PDB Description: solution structure of vanabin2 (ruh-017), a vanadium-binding protein from ascidia sydneiensis samea
PDB Compounds: (A:) vanadium-binding protein 2

SCOP Domain Sequences for d1vfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfia1 g.84.1.1 (A:4-95) Vanadium-binding protein 2, vanabin 2 {Vanadium-rich ascidian (Ascidia sydneiensis samea) [TaxId: 79730]}
fapvdckgqcttpcepltackekcaescetsadkktcrrnckkadcepqdkvcdacrmkc
hkacraancasecpkhehksdtcracmktnck

SCOP Domain Coordinates for d1vfia1:

Click to download the PDB-style file with coordinates for d1vfia1.
(The format of our PDB-style files is described here.)

Timeline for d1vfia1: