Lineage for d1vffa1 (1vff A:1-423)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082923Protein Beta-glucosidase A [51528] (9 species)
  7. 2082961Species Pyrococcus horikoshii [TaxId:53953] [141785] (1 PDB entry)
    Uniprot O58104 1-423
  8. 2082962Domain d1vffa1: 1vff A:1-423 [120033]

Details for d1vffa1

PDB Entry: 1vff (more details), 2.5 Å

PDB Description: beta-glycosidase from Pyrococcus horikoshii
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d1vffa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Pyrococcus horikoshii [TaxId: 53953]}
mplkfpemflfgtatsshqiegnnrwndwwyyeqigklpyrsgkacnhwelyrddiqlmt
slgynayrfsiewsrlfpeenkfnedafmkyreiidllltrgitplvtlhhftsplwfmk
kggflreenlkhwekyiekvaellekvklvatfnepmvyvmmgyltaywppfirspfkaf
kvaanllkahaiayellhgkfkvgivknipiilpasdkerdrkaaekadnlfnwhfldai
wsgkyrgvfktyripqsdadfigvnyytasevrhtwnplkfffevkladiserktqmgws
vypkgiymalkkasrygrplyitengiatlddewrvefiiqhlqyvhkaiedgldvrgyf
ywsfmdnyewkegfgprfglvevdyqtferrprksayvygeiarskeikdellkryglpe
lql

SCOPe Domain Coordinates for d1vffa1:

Click to download the PDB-style file with coordinates for d1vffa1.
(The format of our PDB-style files is described here.)

Timeline for d1vffa1: