Lineage for d1vfca1 (1vfc A:438-500)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761440Family a.4.1.4: DNA-binding domain of telomeric protein [46745] (2 proteins)
    part of Pfam PF00249 (Myb/SANT domain)
  6. 761448Protein Telomeric repeat binding factor 2, TRF2 [116784] (1 species)
  7. 761449Species Human (Homo sapiens) [TaxId:9606] [116785] (4 PDB entries)
    Uniprot Q15554 446-500 # structure of dimerisation domain (43-245) is also known ((63605))
  8. 761454Domain d1vfca1: 1vfc A:438-500 [120032]
    automatically matched to 1XG1 A:5-67

Details for d1vfca1

PDB Entry: 1vfc (more details)

PDB Description: solution structure of the dna complex of human trf2
PDB Compounds: (A:) telomeric repeat binding factor 2

SCOP Domain Sequences for d1vfca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfca1 a.4.1.4 (A:438-500) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]}
edsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkrl
gmn

SCOP Domain Coordinates for d1vfca1:

Click to download the PDB-style file with coordinates for d1vfca1.
(The format of our PDB-style files is described here.)

Timeline for d1vfca1: