SCOP 1.73: Domain d1vfca1: 1vfc A:438-500

Lineage for d1vfca1 (1vfc A:438-500)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (17 families)
   consists only of helices

5. Family a.4.1.4: DNA-binding domain of telomeric protein [46745] (2 proteins)
   part of Pfam PF00249 (Myb/SANT domain)

6. Protein Telomeric repeat binding factor 2, TRF2 [116784] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116785] (4 PDB entries)

8. Domain d1vfca1: 1vfc A:438-500 [120032]
   automatically matched to 1XG1 A:5-67

Details for d1vfca1

PDB Entry: 1vfc

PDB Description: solution structure of the dna complex of human trf2

PDB Compounds: (A:) telomeric repeat binding factor 2

SCOP Domain Sequences for d1vfca1:

Sequence; same for both SEQRES and ATOM records:

>d1vfca1 a.4.1.4 (A:438-500) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]}
edsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkrl
gmn

Timeline for d1vfca1:

• d1vfca1 is new in SCOP 1.73
  
• d1vfca1 appears in SCOP 1.75
  
• d1vfca1 appears in the current release, SCOPe 2.08