Lineage for d1vf9a1 (1vf9 A:438-500)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634573Family a.4.1.4: DNA-binding domain of telomeric protein [46745] (2 proteins)
    part of Pfam PF00249 (Myb/SANT domain)
  6. 634581Protein Telomeric repeat binding factor 2, TRF2 [116784] (1 species)
  7. 634582Species Human (Homo sapiens) [TaxId:9606] [116785] (4 PDB entries)
  8. 634586Domain d1vf9a1: 1vf9 A:438-500 [120031]
    automatically matched to 1XG1 A:5-67

Details for d1vf9a1

PDB Entry: 1vf9 (more details)

PDB Description: Solution Structure Of Human Trf2
PDB Compounds: (A:) telomeric repeat binding factor 2

SCOP Domain Sequences for d1vf9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf9a1 a.4.1.4 (A:438-500) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]}
edsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkrl
gmn

SCOP Domain Coordinates for d1vf9a1:

Click to download the PDB-style file with coordinates for d1vf9a1.
(The format of our PDB-style files is described here.)

Timeline for d1vf9a1: