SCOPe 2.08: Domain d1vf9a_: 1vf9 A:

Lineage for d1vf9a_ (1vf9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.4: DNA-binding domain of telomeric protein [46745] (3 proteins)
   part of Pfam PF00249 (Myb/SANT domain)

6. Protein Telomeric repeat binding factor 2, TRF2 [116784] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116785] (4 PDB entries)
   Uniprot Q15554 446-500 # structure of dimerisation domain (43-245) is also known (63605)

8. Domain d1vf9a_: 1vf9 A: [120031]
   automated match to d1xg1a1

Details for d1vf9a_

PDB Entry: 1vf9

PDB Description: solution structure of human trf2

PDB Compounds: (A:) telomeric repeat binding factor 2

SCOPe Domain Sequences for d1vf9a_:

Sequence; same for both SEQRES and ATOM records:

>d1vf9a_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]}
medsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkr
lgmn

Timeline for d1vf9a_:

• d1vf9a_ first appeared in SCOP 1.73, called d1vf9a1
  
• d1vf9a_ appears in SCOPe 2.07