Lineage for d1vf9a_ (1vf9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981505Family a.4.1.4: DNA-binding domain of telomeric protein [46745] (3 protein domains)
    part of Pfam PF00249 (Myb/SANT domain)
  6. 1981513Protein Telomeric repeat binding factor 2, TRF2 [116784] (1 species)
  7. 1981514Species Human (Homo sapiens) [TaxId:9606] [116785] (4 PDB entries)
    Uniprot Q15554 446-500 # structure of dimerisation domain (43-245) is also known (63605)
  8. 1981518Domain d1vf9a_: 1vf9 A: [120031]
    automated match to d1xg1a1

Details for d1vf9a_

PDB Entry: 1vf9 (more details)

PDB Description: Solution Structure Of Human Trf2
PDB Compounds: (A:) telomeric repeat binding factor 2

SCOPe Domain Sequences for d1vf9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf9a_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]}
medsttnitkkqkwtveesewvkagvqkygegnwaaisknypfvnrtavmikdrwrtmkr
lgmn

SCOPe Domain Coordinates for d1vf9a_:

Click to download the PDB-style file with coordinates for d1vf9a_.
(The format of our PDB-style files is described here.)

Timeline for d1vf9a_: