Lineage for d1vf8a1 (1vf8 A:1-245,A:316-373)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1340705Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1340830Protein Chitinase-like lectin ym1, saccharide binding domain [63910] (1 species)
  7. 1340831Species Mouse (Mus musculus) [TaxId:10090] [63911] (2 PDB entries)
  8. 1340832Domain d1vf8a1: 1vf8 A:1-245,A:316-373 [120029]
    Other proteins in same PDB: d1vf8a2
    automated match to d1e9la1

Details for d1vf8a1

PDB Entry: 1vf8 (more details), 1.31 Å

PDB Description: The Crystal Structure of Ym1 at 1.31 A Resolution
PDB Compounds: (A:) secretory protein

SCOPe Domain Sequences for d1vf8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf8a1 c.1.8.5 (A:1-245,A:316-373) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]}
yqlmcyytswakdrpiegsfkpgnidpclcthliyafagmqnneitytheqdlrdyealn
glkdkntelktllaiggwkfgpapfsamvstpqnrqifiqsvirflrqynfdglnldwqy
pgsrgsppkdkhlfsvlvkemrkafeeesvekdiprllltstgagiidviksgykipels
qsldyiqvmtydlhdpkdgytgensplykspydigksadlnvdsiisywkdhgaasekli
vgfpaXdnvrsfklkaqwlkdnnlggavvwpldmddfsgsfchqrhfpltstlkgdlnih
sasc

SCOPe Domain Coordinates for d1vf8a1:

Click to download the PDB-style file with coordinates for d1vf8a1.
(The format of our PDB-style files is described here.)

Timeline for d1vf8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vf8a2